Protein coding transcript 68769

• Transcript: Ll_transcript_468420
• CDS coordinates: 3-311 (+)
• Peptide sequence: RRIENTTNRQVTFCKRRNGRLKKAYDLYVLCDAEVALIVFSTRGRLYEYANNRSFEGFEHKEHNDFCDVVKMSFFLFLSLFYATKFNFPFFTSILAFSFYEL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_468420

• Blastp: Floral homeotic protein AGAMOUS from Panax with 92.31% of identity
• Blastx: Floral homeotic protein AGAMOUS from Panax with 92.31% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014517920.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;