| Transcript | Ll_transcript_468218 |
|---|---|
| CDS coordinates | 214-519 (+) |
| Peptide sequence | MVEACVSTTFSVALIVGVVIWLWRILNSYWFRPKMLERLLREQGLKGNPYRPLSGDINDLFKSRKEAESKPMPISDDIIPRVSSYLYQSVNKYGMYVYNVW* |
| ORF Type | complete |
| Blastp | Cytochrome P450 72A15 from Arabidopsis with 48.98% of identity |
|---|---|
| Blastx | Secologanin synthase from Catharanthus with 42.39% of identity |
| Eggnog | Cytochrome p450(COG2124) |
| Kegg | Link to kegg annotations (AT3G14690) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019430018.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer