Protein coding transcript 68777

• Transcript: Ll_transcript_468221
• CDS coordinates: 80-385 (+)
• Peptide sequence: MVEASVSTALFVTLIVGVVIWLWRILNSFWFRPKKLERLLREQGLKGNPYRPLSGDINDFFKSRKEAQSKPMPLSDDIISRVSSYLHQSVNKYGMYVYNVW*
• ORF Type: complete

Annotations of Ll_transcript_468221

• Blastp: Secologanin synthase from Catharanthus with 41.11% of identity
• Blastx: Secologanin synthase from Catharanthus with 41.11% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAA33106)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430018.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;