Protein coding transcript 688

• Transcript: Ll_transcript_458832
• CDS coordinates: 2-553 (+)
• Peptide sequence: YNKFAGFLPDNKLFRQLSLRDLAGNQGLCTSGQDSCFVYGSGKKGMALNESGVRKSRMLKLTIGLLITLTVIMVVMGITAVIKARRGIRDDDSELGGDSWSWQFIPFQKLNFSVDQVLRCLVDINVIGKGCSGVVYRAEMDNGEVIAVKKLWPITTEAGEAFKEEKSGVRDSFSTEVKTLGSIR
• ORF Type: internal

Annotations of Ll_transcript_458832

• Blastp: LRR receptor-like serine/threonine-protein kinase RCH1 from Arabidopsis with 57.84% of identity
• Blastx: Receptor-like protein kinase 2 from Arabidopsis with 62.37% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT5G48940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428632.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;