Transcript | Ll_transcript_467076 |
---|---|
CDS coordinates | 1470-2111 (+) |
Peptide sequence | MFLSFSFEMSQKLRQVFAENELPPRSTKVDLSKEFGLSVEKVSKWFKNARYVALKARKLQGADQLHSFTPRKNSTLQNMGEAEVLKSKASKITVNHSTKNAKNVTAKMKTKSDSSTLRKRQPEIFSPQPSENVNKDIMEISDDVSLKKLLKKRKRKAKFSFEGGYQEAEFEFERLSKLKIKLDSMKQKLSAIQNYRGNSSYEPQQKEPSTIFVP |
ORF Type | 3prime_partial |
Blastp | Pathogenesis-related homeodomain protein from Arabidopsis with 40.26% of identity |
---|---|
Blastx | Pathogenesis-related homeodomain protein from Arabidopsis with 50.87% of identity |
Eggnog | PHD finger protein(ENOG410XQQA) |
Kegg | Link to kegg annotations (AT4G29940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442538.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer