Transcript | Ll_transcript_467086 |
---|---|
CDS coordinates | 382-930 (+) |
Peptide sequence | MKLNSRGSRKSSHSDAQAESKPDSSLRFKITRHRGKMHMLKSKSRTHKVDPNTPRKKVTDSSIKGPSKVSSTKKLIIKQSSHKADGKFPQNMSSNLQCKKVREKEKHDGEVNLQKVKRGRKKKRQRNNVNLDDASRLQRRTRYLIIKMKLEQNLIDAYSAEGWKGQRYRKKILCSLKKAFGK* |
ORF Type | complete |
Blastp | Pathogenesis-related homeodomain protein from Arabidopsis with 58.73% of identity |
---|---|
Blastx | Pathogenesis-related homeodomain protein from Arabidopsis with 60.34% of identity |
Eggnog | PHD finger protein(ENOG410XQQA) |
Kegg | Link to kegg annotations (AT4G29940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442565.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer