Protein coding transcript 68924

• Transcript: Ll_transcript_467068
• CDS coordinates: 327-875 (+)
• Peptide sequence: MKLNSRGSRKSSHSDAQAESKPDSSLRFKITRHRGKMHMLKSKSRTHKVDPNTPRKKVTDSSIKGPSKVSSTKKLIIKQSSHKADGKFPQNMSSNLQCKKVREKEKHDGEVNLQKVKRGRKKKRQRNNVNLDDASRLQRRTRYLIIKMKLEQNLIDAYSAEGWKGQRYRKKILCSLKKAFGK*
• ORF Type: complete

Annotations of Ll_transcript_467068

• Blastp: Pathogenesis-related homeodomain protein from Arabidopsis with 58.73% of identity
• Blastx: Pathogenesis-related homeodomain protein from Arabidopsis with 60.34% of identity
• Eggnog: PHD finger protein(ENOG410XQQA)
• Kegg: Link to kegg annotations (AT4G29940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442565.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;