Protein coding transcript 68999

• Transcript: Ll_transcript_466023
• CDS coordinates: 1-513 (+)
• Peptide sequence: GKGSTSFFATSPDYAHIANRMGSEYLAKLLSKHLESVIRSRIPGIASLINRTIEDLEAEMRHLGRPVAVDAGAQLYTILGLCRNFERVFKEHLDGGRPGGDQIYLVFDHQLPTAFRKLPMDRHLSLQNVRKVISESDGYQPHLIAPEHGYRRLLESSLNYFKGPAQASVDA
• ORF Type: internal

Annotations of Ll_transcript_466023

• Blastp: Dynamin-related protein 1E from Arabidopsis with 74.55% of identity
• Blastx: Dynamin-related protein 1E from Arabidopsis with 74.55% of identity
• Eggnog: Dynamin family(COG0699)
• Kegg: Link to kegg annotations (AT3G60190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421781.1)
• Pfam: Dynamin central region (PF01031.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;