Protein coding transcript 6903

• Transcript: Ll_transcript_527561
• CDS coordinates: 51-401 (+)
• Peptide sequence: MNKKSLAFVAKTISTKLHVPLLQCRFFSSHSSPPSTNKLFVGGLSWSVDEKSLIDAFSSFGDVTEVRIVYDKDSGRSRGFGFVIFTNEDNAKCAKDAMDGKVRFQQYQLFLPMSSF*
• ORF Type: complete

Annotations of Ll_transcript_527561

• Blastp: Glycine-rich RNA-binding protein 4, mitochondrial from Arabidopsis with 59.09% of identity
• Blastx: Glycine-rich RNA-binding protein 4, mitochondrial from Arabidopsis with 59.09% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT3G23830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462169.1)
• Pfam: RNA recognition motif (PF16367.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;