Transcript | Ll_transcript_467735 |
---|---|
CDS coordinates | 60-926 (+) |
Peptide sequence | MQYIKPAFRNANHTFTLLRFSLNPFILVSLPNHKFETFRRSHPVSSFSSSSMANGDNPLSSHSLEKQFETFRTELEESGTLRDRIRSVVSEIESTTRVMYATLLLVHQSRSIDELLEKAKSQIDVLKEKYKQLAQILGGCSGQYYRYHGDWKSETQSVVSLLTFMHWLETGSLLEHKEAEDKLGLNNSEFGLDVEDYLIGLCFMSNELPRYVVNQVTAGDYDCPRKVLKFLTDLHAAFRLLNLRNDFLRKKFDGMKYDLRKVEEVYYDVKIRGLTPNGESVGDKGVEG* |
ORF Type | complete |
Blastp | Translin from Gallus with 37.39% of identity |
---|---|
Blastx | Translin from Gallus with 37.39% of identity |
Eggnog | Translin(ENOG410XR87) |
Kegg | Link to kegg annotations (395955) |
CantataDB | Link to cantataDB annotations (CNT0001613) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444323.1) |
Pfam | Translin family (PF01997.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer