| Transcript | Ll_transcript_467724 |
|---|---|
| CDS coordinates | 60-425 (+) |
| Peptide sequence | MQYIKPAFRNAFNTFTSSRFSLNPKPFILVSLPNLTFETFRRSHPVSSFSSLSMADGDNYAPSHSLEKQFETFRTELEESGTLRDRIRSVVSEIESTTRVMYATLLLVHQSRSINGFLPFQ* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Translin from Gallus with 34.1% of identity |
| Eggnog | Translin(ENOG410XR87) |
| Kegg | Link to kegg annotations (395955) |
| CantataDB | Link to cantataDB annotations (CNT0001613) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019424684.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer