| Transcript | Ll_transcript_467713 |
|---|---|
| CDS coordinates | 1-375 (+) |
| Peptide sequence | SCFGCIGAVTRSGCCLSFYSVLVVLLILAELGCAAFIFFDKSWKEEIPADKTGAFDMIYGFLRENWNLVKWVALGIVIFEALLFFLAIVVRAANKPADYDSDDEYINPRQQARQPLLNKPAGPAT |
| ORF Type | internal |
| Blastp | Tobamovirus multiplication protein 2A from Arabidopsis with 68% of identity |
|---|---|
| Blastx | Tobamovirus multiplication protein 2A from Arabidopsis with 68% of identity |
| Eggnog | Tetraspanin family(ENOG4111KWC) |
| Kegg | Link to kegg annotations (AT1G32400) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019424264.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer