Protein coding transcript 69147

• Transcript: Ll_transcript_466346
• CDS coordinates: 154-714 (+)
• Peptide sequence: MCVLWVLTRSLNLCTSNLKSCSKLYYFNHPFQFLNFTTHTVYQQQYQSRRNLIFHSSASEFVKLHNLQGSDSGIVDVRLDRPGAKNAIGKDMLQGLRHTLELIEQNSYTNVAIISSSVPGVFCAGADLKERRTMNESEVKDFVNSLRSTFSYLEAVRVPTIAVIEGVALGGGLEMALACDIRISGS*
• ORF Type: complete

Annotations of Ll_transcript_466346

• Blastp: Probable enoyl-CoA hydratase 2, mitochondrial from Arabidopsis with 63.31% of identity
• Blastx: Probable enoyl-CoA hydratase 2, mitochondrial from Arabidopsis with 48.05% of identity
• Eggnog: Enoyl-CoA hydratase(COG1024)
• Kegg: Link to kegg annotations (AT4G16800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446052.1)
• Pfam: Enoyl-CoA hydratase/isomerase (PF00378.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;