Protein coding transcript 692

• Transcript: Ll_transcript_522890
• CDS coordinates: 2-340 (+)
• Peptide sequence: LEKKFSGKHVVFVGERKILPKPTRKTRTKNKQKRPRSRTLTAVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTNIEHKVDTFASVYKKLTGREVSFEFPEPYL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_522890

• Blastp: 40S ribosomal protein S7 from Manduca with 91.07% of identity
• Blastx: 40S ribosomal protein S7 from Spodoptera with 90.18% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016194769.1)
• Pfam: Ribosomal protein S7e (PF01251.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;