Transcript | Ll_transcript_522890 |
---|---|
CDS coordinates | 2-340 (+) |
Peptide sequence | LEKKFSGKHVVFVGERKILPKPTRKTRTKNKQKRPRSRTLTAVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTNIEHKVDTFASVYKKLTGREVSFEFPEPYL* |
ORF Type | 5prime_partial |
Blastp | 40S ribosomal protein S7 from Manduca with 91.07% of identity |
---|---|
Blastx | 40S ribosomal protein S7 from Spodoptera with 90.18% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016194769.1) |
Pfam | Ribosomal protein S7e (PF01251.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer