| Transcript | Ll_transcript_466607 |
|---|---|
| CDS coordinates | 1787-2146 (+) |
| Peptide sequence | MLNTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHTIKSHVTAATGAIALIQLQEDVKKQLTMEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIESTLSRVCQMVAFATPLHFFR* |
| ORF Type | complete |
| Blastp | Chaperone protein dnaJ 10 from Arabidopsis with 83.49% of identity |
|---|---|
| Blastx | Chaperone protein dnaJ 10 from Arabidopsis with 80.49% of identity |
| Eggnog | DNAj domain protein(COG2214) |
| Kegg | Link to kegg annotations (AT1G76700) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019423124.1) |
| Pfam | X-domain of DnaJ-containing (PF14308.5) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer