Protein coding transcript 69203

• Transcript: Ll_transcript_466608
• CDS coordinates: 1787-2338 (+)
• Peptide sequence: MLNTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHTIKSHVTAATGAIALIQLQEDVKKQLTMEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIESTLSRVCQMVLQDNSAKKEELRARAKGLKSLGKIFQRVKSVDVNENGKVSNETVHKLNGSESSNDACPASKSPKSSSPDFSEFD*
• ORF Type: complete

Annotations of Ll_transcript_466608

• Blastp: Chaperone protein dnaJ 10 from Arabidopsis with 71.43% of identity
• Blastx: Chaperone protein dnaJ 10 from Arabidopsis with 71.35% of identity
• Eggnog: DNAj domain protein(COG2214)
• Kegg: Link to kegg annotations (AT1G76700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423124.1)
• Pfam: X-domain of DnaJ-containing (PF14308.5)
• Rfam: -
• GO: -