Protein coding transcript 69208

• Transcript: Ll_transcript_466595
• CDS coordinates: 222-851 (+)
• Peptide sequence: MLFGSELFEEYIGQLAMASMASMDIFTEGEQFDAKKLQEKMRVVQKEREEKLAEILKSRLNQYVQGNKEDFIIQAEAEVARLSNAAYGVDMLNTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHTIKSNLTAATGIIALFQLHEDVKKQLNSEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIESTLSRVCQLVAFATPLHFFR*
• ORF Type: complete

Annotations of Ll_transcript_466595

• Blastp: Chaperone protein dnaJ 10 from Arabidopsis with 83.42% of identity
• Blastx: Chaperone protein dnaJ 10 from Arabidopsis with 71.64% of identity
• Eggnog: DNAj domain protein(COG2214)
• Kegg: Link to kegg annotations (AT1G76700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423125.1)
• Pfam: X-domain of DnaJ-containing (PF14308.5)
• Rfam: -
• GO: -