Transcript | Ll_transcript_466596 |
---|---|
CDS coordinates | 1787-2410 (+) |
Peptide sequence | MLNTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHTIKSHVTAATGAIALIQLQEDVKKQLTMEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIESTLSRVCQMVLQDNSAKKEELRARAKGLKSLGKIFQRVKSVDVNENGKVSNETVHKLNGSESSNDACPASKSPKSSSPDFSEVQFFSHIFQLVFHFRTIYANHLMLLE* |
ORF Type | complete |
Blastp | Chaperone protein dnaJ 10 from Arabidopsis with 71.43% of identity |
---|---|
Blastx | Chaperone protein dnaJ 10 from Arabidopsis with 71.35% of identity |
Eggnog | DNAj domain protein(COG2214) |
Kegg | Link to kegg annotations (AT1G76700) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423124.1) |
Pfam | X-domain of DnaJ-containing (PF14308.5) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer