Transcript | Ll_transcript_527576 |
---|---|
CDS coordinates | 55-1173 (+) |
Peptide sequence | MSEYANKKTRGAFIAAVFAMQGFGILAGGIFAIIIATTFKNKFVAPTYEADPLGSTVPQADYVWRIILMFGAIPAAMTFYSRSKMPETARYTALVAKNTEQAAKDMAKVMQMEIGVAPKREEEQAQPHQFGLFSKEFFARHGLHLLGTCSTWFLLDIAFYSQNLFQKDIFTAIGWIPPAKTMNALEEVYRIARAQTLIALCSTVPGYWFTVAFIDRIGRFAIQLMGFFFMTVFMFALAIPYDHWTHKENRIGFVVMYSLTFFFANFGPNATTFVVPAEIFPARFRSTCHGISSASGKLGAMVGAFGFLYLAQNQDKSKVEAGYTAGIGVKNSLIVLGVVNILGFLFTFLVPESNGKSLEEMSGENEEEETKA* |
ORF Type | complete |
Blastp | Probable inorganic phosphate transporter 1-7 from Arabidopsis with 82.11% of identity |
---|---|
Blastx | Probable inorganic phosphate transporter 1-7 from Arabidopsis with 83.24% of identity |
Eggnog | phosphate transporter(ENOG410ZVN7) |
Kegg | Link to kegg annotations (AT3G54700) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459068.1) |
Pfam | Sugar (and other) transporter (PF00083.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer