Protein coding transcript 69261

• Transcript: Ll_transcript_465934
• CDS coordinates: 26-550 (+)
• Peptide sequence: MVVVDRLSKYAHFIPLQHPYTSKDVAQAFIKEVIRLHGFSASIMSDRDRVFMSMFWKALFRLAGTRLRFSSAYHPQTDGQTEVVNRTVETYLRCFVNDHPRQWIKWLAWVELWFNCSHNASIQMSPFKAFYGQDPPSIISFDNGSTSVAAVDLLLRDRDLMLAALKSHLARAQR*
• ORF Type: complete

Annotations of Ll_transcript_465934

• Blastp: Transposon Tf2-11 polyprotein from Schizosaccharomyces with 35.66% of identity
• Blastx: Transposon Tf2-11 polyprotein from Schizosaccharomyces with 35.66% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC1289.17)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017423745.1)
• Pfam: Integrase core domain (PF00665.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;