Transcript | Ll_transcript_466733 |
---|---|
CDS coordinates | 2-1159 (+) |
Peptide sequence | NYYNNLINEVLAKGLQPFVTIFHWDLPQALEEEYGGFLSPSIVNDFEDYAELCFKEFGDRVKHWITLNEPWTFSQNGYALGVFAPGRCSAWQNQNCTGGDSATEPYIVSHHMLLAHAAAVNVYRTKYQTSQKGLIGITLIADWFLPLTDTKLDQQAAQRALDFMFGWYMEPLTKGSYPKSMQSLVKNRLPKFSSDQIKLLIGSFDFIGLNYYTSSYAANAPPSSGLRPNYLTDSHVNLLNERNGTSIGPTAASFWLYVYPRGILDVLLYIKHKYNNPVIYITENGVDELDDPNLSLEEALNDTYRIDYHYQHLYYLQIAIKNGVNVKGYFTWSLMDNFNWDSGYTMRFGIYFVDYKNGLKRHPKLSAHWFKNSLQHRKLDLDDSG* |
ORF Type | 5prime_partial |
Blastp | Beta-glucosidase 12 from Oryza sativa with 64.08% of identity |
---|---|
Blastx | Beta-glucosidase 12 from Oryza sativa with 64.08% of identity |
Eggnog | beta-glucosidase(COG2723) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436806.1) |
Pfam | Glycosyl hydrolase family 1 (PF00232.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer