Protein coding transcript 69266

• Transcript: Ll_transcript_466735
• CDS coordinates: 2-745 (+)
• Peptide sequence: NYYNNLINEVLAKGLQPFVTIFHWDLPQALEEEYGGFLSPSIVNDFEDYAELCFKEFGDRVKHWITLNEPWTFSQNGYALGVFAPGRCSAWQNQNCTGGDSATEPYIVSHHMLLAHAAAVNVYRTKYQTSQKGLIGITLIADWFLPLTDTKLDQQAAQRALDFMFGWYMEPLTKGSYPKSMQSLVKNRLPKFSSDQIKLLIGSFDFIGLNYYTSSYAANAPPSSGLRPNYLTDSHVNLLSNNTFLHI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_466735

• Blastp: Beta-glucosidase 12 from Oryza sativa with 65.4% of identity
• Blastx: Beta-glucosidase 12 from Oryza sativa with 65.4% of identity
• Eggnog: beta-glucosidase(COG2723)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436806.1)
• Pfam: Glycosyl hydrolase family 1 (PF00232.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;