Protein coding transcript 69306

• Transcript: Ll_transcript_468287
• CDS coordinates: 507-890 (+)
• Peptide sequence: MLPAIDLTANVFLIERISARSGKAACGDIVVLRSPQNPRKFITKRLVGIEGDTVTYVSSPDNSDKCETVVVPKGHVGYREITFINPLIQEILVLFLMDLFRAGYFGGYHHLKILDLSGKTDLKHSIE*
• ORF Type: complete

Annotations of Ll_transcript_468287

• Blastp: Mitochondrial inner membrane protease subunit 2 from Xenopus with 37.5% of identity
• Blastx: Mitochondrial inner membrane protease subunit 1 from Silurana with 62.22% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (495969)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013445096.1)
• Pfam: Peptidase S24-like (PF00717.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;