Protein coding transcript 69333

• Transcript: Ll_transcript_468198
• CDS coordinates: 180-779 (+)
• Peptide sequence: MASSINVFTTITLNPCINFPRRQPNSVTFAAVNSPESPPPEIELQFIGPKKVGSDGSYPIDEVKAISGEKLMRNIMLDNKLDLYATYGKLMNCAGGGSCGTCIVEIIEGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKNGVTWICYSLQILGTHLSLNKAYNWNLSNEENYSMEKIICQCLCLYLFAYSK*
• ORF Type: complete

Annotations of Ll_transcript_468198

• Blastp: Photosynthetic NDH subunit of subcomplex B 3, chloroplastic from Arabidopsis with 38.73% of identity
• Blastx: Photosynthetic NDH subunit of subcomplex B 3, chloroplastic from Arabidopsis with 38.73% of identity
• Eggnog: Ferredoxin(COG0633)
• Kegg: Link to kegg annotations (AT3G16250)
• CantataDB: Link to cantataDB annotations (CNT0001788)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447530.1)
• Pfam: 2Fe-2S iron-sulfur cluster binding domain (PF00111.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;