Transcript | Ll_transcript_468199 |
---|---|
CDS coordinates | 180-656 (+) |
Peptide sequence | MASSINVFTTITLNPCINFPRRQPNSVTFAAVNSPESPPPEIELQFIGPKKVGSDGSYPIDEVKAISGEKLMRNIMLDNKLDLYATYGKLMNCAGGGSCGTCIVEIIEGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKVVVQRIPQWKK* |
ORF Type | complete |
Blastp | Photosynthetic NDH subunit of subcomplex B 3, chloroplastic from Arabidopsis with 43.59% of identity |
---|---|
Blastx | Photosynthetic NDH subunit of subcomplex B 3, chloroplastic from Arabidopsis with 43.23% of identity |
Eggnog | Ferredoxin(COG0633) |
Kegg | Link to kegg annotations (AT3G16250) |
CantataDB | Link to cantataDB annotations (CNT0001788) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447530.1) |
Pfam | 2Fe-2S iron-sulfur cluster binding domain (PF00111.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer