Protein coding transcript 6939

• Transcript: Ll_transcript_527733
• CDS coordinates: 86-925 (+)
• Peptide sequence: MASLIDQSAIELLHGEAILHNQLFSFMRPMCLKWAVELGIADIIHNHAKPITFPELMLALVQVPPTKASLVKRFMRFLAHNGIFAIHESQEEEHETYSLTPASKLLVKGSDHCLTPFVLWAADPVRVNNYHHLGNWVCGEVPTLYETSLGMSIWEYLEKNPDYMSTFNEGMASDCKLLKLTLKDCSTVFEGLDTIVDVGGGNGTIAKIISELFPKLKIVVYDLPQVVANLQGSNNVSYVAGDMFVSIPQADAVLLKVHVLNSLMFGVLLHFLGNENKEM*
• ORF Type: complete

Annotations of Ll_transcript_527733

• Blastp: Isoflavone 7-O-methyltransferase from Glycyrrhiza with 53.08% of identity
• Blastx: Isoflavone 7-O-methyltransferase from Glycyrrhiza with 53.08% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451688.1)
• Pfam: Dimerisation domain (PF08100.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;