Protein coding transcript 69391

• Transcript: Ll_transcript_467512
• CDS coordinates: 264-1406 (+)
• Peptide sequence: MVSLSTFPFSPPITQNAAFRSVAFVKKLNSFNKLSIKDLHRKFVCACIAPPPPQNFKSEEDSSAIKFNGSSKSEQLSTVRDHEDDSDVLIECREVYKSFGEKKILNGVSFKIRHGEAVGIIGPSGTGKSTVLKIIAGLLAPDKGEVYIRGRKRTGLISDDEISGLRIGLVFQSAALFDSLTVRENVGFLLYENSSMSEDQIADLVTESLAAVGLKGVEDRLPSELSGGMKKRVALARSIIHDTTKASIEPEVLLYDEPTAGLDPIASTVVEDLIRSVHIKGRDALGKPGNITSYVVVTHQHSTIKRAIDRLLFLHKGKLVWEGMTNEFMTSTNPIVQQVGVSCIGPPFLNAFFPCCLKFYFSGASSLKFASGSLDGPIKY*
• ORF Type: complete

Annotations of Ll_transcript_467512

• Blastp: Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic from Arabidopsis with 70.2% of identity
• Blastx: Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic from Arabidopsis with 70.2% of identity
• Eggnog: lipid transport(COG1127)
• Kegg: Link to kegg annotations (AT1G65410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429411.1)
• Pfam: ABC transporter (PF00005.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;