Transcript | Ll_transcript_467515 |
---|---|
CDS coordinates | 999-1457 (+) |
Peptide sequence | MSEDQIADLVTESLAAVGLKGVEDRLPSELSGGMKKRVALARSIIHDTTKASIEPEVLLYDEPTAGLDPIASTVVEDLIRSVHIKGRDALGKPGNITSYVVVTHQHSTIKRAIDRLLFLHKGKLVWEGMTNEFMTSTNPIVQQVSLSSFIRG* |
ORF Type | complete |
Blastp | Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic from Arabidopsis with 79.19% of identity |
---|---|
Blastx | Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic from Arabidopsis with 65.37% of identity |
Eggnog | lipid transport(COG1127) |
Kegg | Link to kegg annotations (AT1G65410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429411.1) |
Pfam | ABC transporter (PF00005.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer