Protein coding transcript 6940

• Transcript: Ll_transcript_527734
• CDS coordinates: 86-409 (+)
• Peptide sequence: MASLIDQSAIELLHGEAILHNQLFSFMRPMCLKWAVELGIADIIHNHAKPITFPELMLALVQVPPTKASLVKRFMHFVAHNGIFAIHESQEQQHEPYSLIQSSELFG*
• ORF Type: complete

Annotations of Ll_transcript_527734

• Blastp: Isoflavone 7-O-methyltransferase from Glycyrrhiza with 47.27% of identity
• Blastx: Isoflavone 7-O-methyltransferase from Glycyrrhiza with 46.79% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418392.1)
• Pfam: Dimerisation domain (PF08100.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;