Transcript | Ll_transcript_466278 |
---|---|
CDS coordinates | 104-646 (+) |
Peptide sequence | MEHCIFSNLKTQPLWLLFLFSLGSITLLRFSFIFLNWVYVNFLRPSKNLKKYGSWALITGPTDGIGKGFAFHLARKGLNLVLVGRSPEKLKDVSDSIAAKFGKIKVVTVVVDFSGDLDSGMEKIREAIEGLDVGVLVNNVGVSYPYARFFHEVDDEILRNLIKVNIEGTTKVIDFPLSSF* |
ORF Type | complete |
Blastp | Very-long-chain 3-oxoacyl-CoA reductase 1 from Arabidopsis with 64.53% of identity |
---|---|
Blastx | Very-long-chain 3-oxoacyl-CoA reductase 1 from Arabidopsis with 64.53% of identity |
Eggnog | Dehydrogenase(COG0300) |
Kegg | Link to kegg annotations (AT1G67730) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414745.1) |
Pfam | short chain dehydrogenase (PF00106.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer