Protein coding transcript 69419

• Transcript: Ll_transcript_466288
• CDS coordinates: 104-1066 (+)
• Peptide sequence: MEHCIFSNLKTQPLWLLFLFSLGSITLLRFSFIFLNWVYVNFLRPSKNLKKYGSWALITGPTDGIGKGFAFHLARKGLNLVLVGRSPEKLKDVSDSIAAKFGKIKVVTVVVDFSGDLDSGMEKIREAIEGLDVGVLVNNVGVSYPYARFFHEVDDEILRNLIKVNIEGTTKVTQVVLPGMIKRKKGAIVNLGSGAAIVIPSDPLYAVYAASKAYIDQFSRCLYVEYKKYGIDVQCQVPLYVATKMASIKRSSFFVPSTDGYAKAGVRWIGYEPRCTPYWPHTLLWALAYSLPESVVDAWRLRFCLGIRKRGQLKDSRKKE*
• ORF Type: complete

Annotations of Ll_transcript_466288

• Blastp: Very-long-chain 3-oxoacyl-CoA reductase 1 from Arabidopsis with 64.69% of identity
• Blastx: Very-long-chain 3-oxoacyl-CoA reductase 1 from Arabidopsis with 64.69% of identity
• Eggnog: Dehydrogenase(COG0300)
• Kegg: Link to kegg annotations (AT1G67730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414746.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;