Protein coding transcript 69446

• Transcript: Ll_transcript_466195
• CDS coordinates: 1590-1928 (+)
• Peptide sequence: MTLHSEHVFSQNDSSIVRMLVGNKCDLENIREVSIEDGKSLAEAEGMFFIETSALDSTNVQTAFEIVIREIYDNMSRKILNSDSYKAKLSANGVSLNNGSGSKESKLGSCCS*
• ORF Type: complete

Annotations of Ll_transcript_466195

• Blastp: Ras-related protein RABA5e from Arabidopsis with 65.38% of identity
• Blastx: Ras-related protein RABA5e from Arabidopsis with 65.38% of identity
• Eggnog: GTP-binding Protein(COG1100)
• Kegg: Link to kegg annotations (AT1G05810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450072.1)
• Pfam: Ras family (PF00071.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;