Transcript | Ll_transcript_466196 |
---|---|
CDS coordinates | 1682-2047 (+) |
Peptide sequence | MQFDSCNVEFNSCINYPAAQNDSSIVRMLVGNKCDLENIREVSIEDGKSLAEAEGMFFIETSALDSTNVQTAFEIVIREIYDNMSRKILNSDSYKAKLSANGVSLNNGSGSKESKLGSCCS* |
ORF Type | complete |
Blastp | Ras-related protein RABA5e from Arabidopsis with 65.38% of identity |
---|---|
Blastx | Ras-related protein RABA5e from Arabidopsis with 65.38% of identity |
Eggnog | GTP-binding Protein(COG1100) |
Kegg | Link to kegg annotations (AT1G05810) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450072.1) |
Pfam | Ras family (PF00071.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer