Protein coding transcript 69448

• Transcript: Ll_transcript_466208
• CDS coordinates: 167-808 (+)
• Peptide sequence: MDSPIGGEEYLFKIVLIGDSAVGKSNLLSRFARNEFDTNSKATIGVEFQTQVVEIEGKEVKAQIWDTAGQERFRAVTSAYYRGALGALVVYDITRKATFDGIKRWLQELDTQNDSSIVRMLVGNKCDLENIREVSIEDGKSLAEAEGMFFIETSALDSTNVQTAFEIVIREIYDNMSRKILNSDSYKAKLSANGVSLNNGSGSKESKLGSCCS*
• ORF Type: complete

Annotations of Ll_transcript_466208

• Blastp: Ras-related protein RABA5b from Arabidopsis with 77.99% of identity
• Blastx: Ras-related protein RABA5b from Arabidopsis with 77.99% of identity
• Eggnog: GTP-binding Protein(COG1100)
• Kegg: Link to kegg annotations (AT3G07410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450072.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;