Transcript | Ll_transcript_527490 |
---|---|
CDS coordinates | 44-1090 (+) |
Peptide sequence | MAPLNPDAPKFIPSEHKLLHQPFTLFCSPLSTPFPHQHCYFPFSSHQLLYHPKVFTRVVPFSSIPFYHHGDANITTKQPLSTTTQTQAEEPTGPYLSEPVIIQEASHVHQKEETKEAHGLKRHASKGMKRGHRGFRHKKEKDVEYQKCLASRNKQNCGRGDAYKHSKTFPIKKRYYSSITPVRVDGEETTVMIRNIPNKYTRDSLVDYLEKQCMLENHKAEDNESGGSVKDCIVLAFDFVYLPIDFKSGLNKGYAFVNFTSPKGAWKFNMTASNMKWDLFQSHKIRKVVAARLQGKEALQKHFESMHFPCESEEVLPICFNPPRDGLTNGSGEQRTIGRLGLFNPRQV* |
ORF Type | complete |
Blastp | Protein terminal ear1 homolog from Oryza sativa with 44.59% of identity |
---|---|
Blastx | Protein terminal ear1 homolog from Oryza sativa with 44.59% of identity |
Eggnog | Rna-binding protein(ENOG4111R9F) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450794.1) |
Pfam | RNA recognition motif 2 (PF04059.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer