Protein coding transcript 69612

• Transcript: Ll_transcript_467446
• CDS coordinates: 920-1276 (+)
• Peptide sequence: MWMPVSQLWTNYLNPENMKGLSAFSILLAMIGNGLLLPRALLVRDFMWFTGSTWATLFYGYGNIACLRFLNIISNEFFLAATVGLVSWIGLTLWKDSVVHGYNSPLDSIHDLVSGPRR*
• ORF Type: complete

Annotations of Ll_transcript_467446

• Blastp: Maltose excess protein 1-like, chloroplastic from Oryza sativa with 70.79% of identity
• Blastx: Maltose excess protein 1, chloroplastic from Arabidopsis with 66.67% of identity
• Eggnog: maltose excess protein(ENOG410ZKZ6)
• Kegg: Link to kegg annotations (4336889)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464845.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;