Protein coding transcript 69620

• Transcript: Ll_transcript_467464
• CDS coordinates: 195-1013 (+)
• Peptide sequence: MTVGAGIYVGDGKLMVLGKKVLSEVNENIMVTPASGGALINAAFLGVSSHHNATRTVFPIGKLQGLRFMCVFRFKMWWMTQRMGSCGKEVPIETQFLLIEAHNGSDIDGGLENQAADSTYVVFLPLLEGDFRAVLQGNDQNELEICVESGCPAVEEFDGTHLVFIGAGSDPYDVITNAVKTVEKHLQTFSHRERKKMPDMLDWFGWCTWDAFYTNVTSEGVEQGVRSFEKGGVPAKFVIIDDGWQSVGMDPNSIGWKSDHAANFANRLTDIKE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_467464

• Blastp: Probable galactinol--sucrose galactosyltransferase 1 from Arabidopsis with 68.86% of identity
• Blastx: Probable galactinol--sucrose galactosyltransferase 1 from Arabidopsis with 68.86% of identity
• Eggnog: raffinose synthase(ENOG410YBU9)
• Kegg: Link to kegg annotations (AT1G55740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435715.1)
• Pfam: Raffinose synthase or seed imbibition protein Sip1 (PF05691.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;