Transcript | Ll_transcript_468394 |
---|---|
CDS coordinates | 1899-2852 (+) |
Peptide sequence | MYDQNTGRPRGFGFISFDNEDTVDRVLHKTFHELNGKNVEVKRALPKDANPGASNHTGGAGVGGYQGYGASGGNQNAYDGRVDSSRYLQPQNAASGFPSYGSSGYSAPGYGYGVANNGIGYGAYGGYSGATAGYGGPAGASYGNPSVPNAAYPGGPPGGPRSSWSGQVPSGYGSAGYGSTGPWGTSNGGAGTGSGGPGSAAAGQSPSAVAGYGNQGYGYGGYSGSDSSYGNPGAYGAVGGRSGSAPNNELQGSGGSYMGSGYSDPNGNSGYGNAAWRSESTQASGNYGTQGNGAAHAGQGGYGGGYGGSQSRQSQQQ* |
ORF Type | complete |
Blastp | Heterogeneous nuclear ribonucleoprotein 1 from Arabidopsis with 55.6% of identity |
---|---|
Blastx | Heterogeneous nuclear ribonucleoprotein 1 from Arabidopsis with 65.84% of identity |
Eggnog | Rna-binding protein(ENOG410YA8Z) |
Kegg | Link to kegg annotations (AT4G14300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449967.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer