Protein coding transcript 69653

• Transcript: Ll_transcript_468382
• CDS coordinates: 1-345 (+)
• Peptide sequence: RKTLDIGKKKVLKTEKTEIMDSDQGKLFIGGISWDTNEDKLKDYFGNYGVVSHASVMRDKNTGKPRGFAFVVFSDPSVVDRVLEDTHVIDGRTEDRFTSSEVEPSVHSWRTLAS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_468382

• Blastp: Heterogeneous nuclear ribonucleoprotein 1 from Arabidopsis with 71.05% of identity
• Blastx: Heterogeneous nuclear ribonucleoprotein 1 from Arabidopsis with 71.05% of identity
• Eggnog: Rna-binding protein(ENOG410YA8Z)
• Kegg: Link to kegg annotations (AT4G14300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449968.1)
• Pfam: RNA recognition motif (PF16367.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;