Protein coding transcript 69654

• Transcript: Ll_transcript_468383
• CDS coordinates: 160-1284 (+)
• Peptide sequence: MDSDQGKIFIGGISWDTNEDKLKDYFGNYGDVSHASVMRDKITGKPRGFAFVVFSDPSVIDRVLQDTHVIDGRTVDVKRALSREDQQSSFNSRSGNSNSARNSGNGGNIRTKKIFVGGLPPTLTEEKFREYFEAYGQVTDVVVMYDQNTGRPRGFGFISFDNEDTVDRVLHKTFHELNGKNVEVKRALPKDANPGASNHTGGAGVGGYQGYGASGGNQNAYDGRVDSSRYLQPQNAASGFPSYGSSGYSAPGYGYGVANNGIGYGAYGGYSGATAGYGGPAGASYGNPSVPNAAYPGGPPGGPRSSWSGQVPSGYGSAGYGSTGPWGTSNGGAGTGSGGPGSAAAGQSPSAVAGYGNQGYGYGGYSGSDSSYGNP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_468383

• Blastp: Heterogeneous nuclear ribonucleoprotein 1 from Arabidopsis with 60.57% of identity
• Blastx: Heterogeneous nuclear ribonucleoprotein 1 from Arabidopsis with 64.68% of identity
• Eggnog: Rna-binding protein(ENOG410YA8Z)
• Kegg: Link to kegg annotations (AT4G14300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449967.1)
• Pfam: RNA recognition motif (PF16367.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;