Protein coding transcript 69659

• Transcript: Ll_transcript_466491
• CDS coordinates: 192-713 (+)
• Peptide sequence: MATPKESYENQQLAIVQHVRNSGMISSNPSPLMDDKEEEMSRSALAMFRAKEEEFERKKMEVRGKVHAYLGRVEEETKRLAEIREELEGLIDPLRKEVGIVRKKIDNVNKELKPMGQTCQRKEREYKEALEALNHKNREKGQLVTNLMEMVNESEKLRMKKLEELSKNLDTLK*
• ORF Type: complete

Annotations of Ll_transcript_466491

• Blastp: RAB6-interacting golgin from Rattus with 32.79% of identity
• Blastx: tRNA dimethylallyltransferase 2 from Arabidopsis with 52.03% of identity
• Eggnog: Golgin, RAB6-interacting(ENOG4111VTM)
• Kegg: Link to kegg annotations (304923)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448813.1)
• Pfam: Transcriptional activator (PF04949.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;