Transcript | Ll_transcript_466488 |
---|---|
CDS coordinates | 192-713 (+) |
Peptide sequence | MATPKESYENQQLAIVQHVRNSGMISSNPSPLMDDKEEEMSRSALAMFRAKEEEFERKKMEVRGKVHAYLGRVEEETKRLAEIREELEGLIDPLRKEVGIVRKKIDNVNKELKPMGQTCQRKEREYKEALEALNHKNREKGQLVTNLMEMVNESEKLRMKKLEELSKNLDTLK* |
ORF Type | complete |
Blastp | RAB6-interacting golgin from Rattus with 32.79% of identity |
---|---|
Blastx | tRNA dimethylallyltransferase 2 from Arabidopsis with 51.85% of identity |
Eggnog | Golgin, RAB6-interacting(ENOG4111VTM) |
Kegg | Link to kegg annotations (304923) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448813.1) |
Pfam | Transcriptional activator (PF04949.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer