Transcript | Ll_transcript_466498 |
---|---|
CDS coordinates | 169-630 (+) |
Peptide sequence | MDDPATAVQDRDDKFLEKAIEEAYRGAECGDGRPFGAVVVQNDGVVVSCHNMVLRNKDPTAHAEITAIREACQKLNQIDLSDCEIYASCEPCPMCLGAIRFSRIKRLVYGAKAESAIVAGFTHKQHLEIKKAEGTIAMLAEQVFEKTKSMFPS* |
ORF Type | complete |
Blastp | Guanine deaminase from Bacillus with 48.62% of identity |
---|---|
Blastx | Guanine deaminase from Bacillus with 48.62% of identity |
Eggnog | deaminase(COG0590) |
Kegg | Link to kegg annotations (BSU13170) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440577.1) |
Pfam | Cytidine and deoxycytidylate deaminase zinc-binding region (PF00383.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer