Protein coding transcript 69673

• Transcript: Ll_transcript_466502
• CDS coordinates: 343-804 (+)
• Peptide sequence: MDDPATAVQDRDDKFLEKAIEEAYRGAECGDGRPFGAVVVQNDGVVVSCHNMVLRNKDPTAHAEITAIREACQKLNQIDLSDCEIYASCEPCPMCLGAIRFSRIKRLVYGAKAESAIVAGFTHKQHLEIKKAEGTIAMLAEQVFEKTKSMFPS*
• ORF Type: complete

Annotations of Ll_transcript_466502

• Blastp: Guanine deaminase from Bacillus with 48.62% of identity
• Blastx: Guanine deaminase from Bacillus with 48.62% of identity
• Eggnog: deaminase(COG0590)
• Kegg: Link to kegg annotations (BSU13170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440577.1)
• Pfam: Cytidine and deoxycytidylate deaminase zinc-binding region (PF00383.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;