Protein coding transcript 697

• Transcript: Ll_transcript_389431
• CDS coordinates: 243-1148 (+)
• Peptide sequence: MGLPTNGTTGENQLKFLIYGRTGWIGGLLGKLCEAQGISYVYGTGRLQNRSSLEADIAEVKPSHVFNAAGVTGRPNVDWCESHKVETITTNVVGTLTLADVCRTKGIILINYATGCIFEYDSLHTLGSGVGFKEEDTPNFIGSFYSKTKAMVEDLLHNYENVCTLRVRMPISSDLSNPRNFITKITRYDKVVDIPNSMTILDELLPISLEMAKRNLTGVWNFTNPGVVSHNEILQLYKDYVDPNFTWKNFTLEEQAKVIVAPRSNNELDASKLKNEFPELLSIKESLIKYVFEPNQTKVNA*
• ORF Type: complete

Annotations of Ll_transcript_389431

• Blastp: Bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose reductase from Arabidopsis with 85.12% of identity
• Blastx: Bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose reductase from Arabidopsis with 85.12% of identity
• Eggnog: dTDP-glucose 4-6-dehydratase(COG1088)
• Kegg: Link to kegg annotations (AT1G63000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421934.1)
• Pfam: RmlD substrate binding domain (PF04321.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;