Protein coding transcript 69711

• Transcript: Ll_transcript_466425
• CDS coordinates: 3-521 (+)
• Peptide sequence: DPPLKSTAISFRLCVFAFLFISISSGSQLIWIAPSGGRDRQDPHTGEMAPAPFEASSVDNMRKLVDHSGPPGHVYPLAISCHEIMPPPMKVEKEIGEKRIISFHGTGLSVAPEISFSEITAACGSPEKAKESYSKALYDSVNEQYDVLRSAIRGKKGLEASTPKVPLSQPWN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_466425

• Blastp: Glycerol-3-phosphate acyltransferase, chloroplastic from Pisum with 78.52% of identity
• Blastx: Glycerol-3-phosphate acyltransferase, chloroplastic from Pisum with 78.52% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (CAA41769)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423898.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;