Transcript | Ll_transcript_466431 |
---|---|
CDS coordinates | 2479-3123 (+) |
Peptide sequence | MSNHQTEADPAIISLLLEKRLSYFAENLTYVAGDRVVTDPLCKPFSIGRNLICVYSKKHMLDDPELVEMKRKANTRSLKEMAMLLRSGSQLIWIAPSGGRDRPDPANGEWFPAPFDPYSVDNMRRLVDHSGPPGHVYPLAILCHDIMPPPMKVEKEIGEKRIISFHGTGLSVAPEISFSDTTAACESPEKVCKFFSVTTLQISLKSHLLSFCDP* |
ORF Type | complete |
Blastp | Glycerol-3-phosphate acyltransferase, chloroplastic from Phaseolus with 84.18% of identity |
---|---|
Blastx | Glycerol-3-phosphate acyltransferase, chloroplastic from Phaseolus with 84.06% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421862.1) |
Pfam | Acyltransferase (PF01553.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer