Protein coding transcript 69725

• Transcript: Ll_transcript_466411
• CDS coordinates: 2479-3144 (+)
• Peptide sequence: MSNHQTEADPAIISLLLEKRLSYFAENLTYVAGDRVVTDPLCKPFSIGRNLICVYSKKHMLDDPELVEMKRKANTRSLKEMAMLLRSGSQLIWIAPSGGRDRPDPANGEWFPAPFDPYSVDNMRRLVDHSGPPGHVYPLAILCHDIMPPPMKVEKEIGEKRIISFHGTGLSVAPEISFSDTTAACESPEKAKEAYSKAVYISVNEQYNVLKSAIHGKKGLEA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_466411

• Blastp: Glycerol-3-phosphate acyltransferase, chloroplastic from Pisum with 84.68% of identity
• Blastx: Glycerol-3-phosphate acyltransferase, chloroplastic from Pisum with 84.12% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (CAA41769)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421862.1)
• Pfam: Acyltransferase (PF01553.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;