Transcript | Ll_transcript_466966 |
---|---|
CDS coordinates | 200-817 (+) |
Peptide sequence | MDVTRLCSAATPLSRVGSTQKKYNYPSFSFTTTLLNHRNHSSFSIPIPPFNNFKPLHFSQFNINHPFNLLSASKGQLHLLQPSGVDELYDALVSRLLHSTTISSNPNSKHLVALAGPPGAGKSTLANEVASRVNKLWSEKASSIDSQVKPPDVAIVIPMDGFHLYRSELDAMEVSVLLLLTNFVSTSNFILVHFIILSFLLILSS* |
ORF Type | complete |
Blastp | Putative uridine kinase C227.14 from Schizosaccharomyces with 37.36% of identity |
---|---|
Blastx | Putative uridine kinase C227.14 from Schizosaccharomyces with 34.81% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPAC227.14) |
CantataDB | Link to cantataDB annotations (CNT0001606) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444479.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer