| Transcript | Ll_transcript_466962 |
|---|---|
| CDS coordinates | 277-651 (+) |
| Peptide sequence | MEFLSAFCYCYLVKQIIQGSVYVPSFDHGVGDPVEDDIFVNLQHKIIIVEGNYLLLEDGIWKEISSFFDEKCVLFYLIQAHANRPLPKTKIRALFGIIYYLVQSTTFVVHHFLKELTKCQNSVF* |
| ORF Type | complete |
| Blastp | Putative uridine kinase C227.14 from Schizosaccharomyces with 44.12% of identity |
|---|---|
| Blastx | Putative uridine kinase C227.14 from Schizosaccharomyces with 44.12% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPAC227.14) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017442963.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer